SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000440374 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440374
Domain Number 1 Region: 594-783
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-53
Family DBL homology domain (DH-domain) 0.00000000721
Further Details:      
 
Domain Number 2 Region: 788-928
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-39
Family Pleckstrin-homology domain (PH domain) 0.000000125
Further Details:      
 
Domain Number 3 Region: 274-424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1027-1083
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000945
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 41-195
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000497
Family CRAL/TRIO domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSP00000440374
Domain Number - Region: 431-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0317
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440374   Gene: ENSG00000126217   Transcript: ENST00000535094
Sequence length 1125
Comment pep:known chromosome:GRCh38:13:112969221:113097074:1 gene:ENSG00000126217 transcript:ENST00000535094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFWLRTEEMALEEMVQRLNAVSKHTDEIMHQDIVPLCAADIQDQLKKRFAYLSGGRGQD
GSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRDKWTSVKASVL
RIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGYIDKS
QLTEDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSV
LCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLN
ETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKAILDAASQKIATFTDIGNSLAHVEHL
LRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAEIARR
RGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENK
IQELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAP
RPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGEEEESLAI
LRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEIYH
FHNRIFLRELENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPFFQEC
QRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALSSILGILKAVND
SMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVL
FCKKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTP
EIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKKLEER
KTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGL
GPKKLVPGKYTVVADHEKGGPDALRVRSGDVVELVQEGDEGLWYVRDPTTGKEGWVPASS
LSVRLGPSGSAQCLSSSESSPGSAVLSNSSSCSEGGQAPFSDLQG
Download sequence
Identical sequences ENSP00000440374 NP_001106203.2.87134 NP_001106203.2.92137 ENSP00000440374 gi|339276000|ref|NP_001106203.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]