SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442609 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442609
Domain Number 1 Region: 5-197
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-62
Family Dual specificity phosphatase-like 0.00000000515
Further Details:      
 
Domain Number 2 Region: 248-438
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.84e-34
Family mRNA capping enzyme 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442609   Gene: ENSG00000111880   Transcript: ENST00000538899
Sequence length 457
Comment pep:known chromosome:GRCh38:6:88769770:88963409:-1 gene:ENSG00000111880 transcript:ENST00000538899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVK
MGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNPPE
LIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEDEDGKKESEPGSSASFGKRRKERLKLGAIFLEGVTVKG
VTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICT
SRKKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEG
Download sequence
Identical sequences A0A2J8PVA9 A0A2J8VRP2
ENSP00000442609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]