SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000449373 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449373
Domain Number 1 Region: 39-134
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.39e-34
Family Pyridoxal-dependent decarboxylase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449373   Gene: ENSG00000139631   Transcript: ENST00000548698
Sequence length 135
Comment pep:putative chromosome:GRCh38:12:53161164:53173770:-1 gene:ENSG00000139631 transcript:ENST00000548698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKCHYSIQKGAAFLGLGTDS
VRVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHG
LWLHVDAAWGGSVLL
Download sequence
Identical sequences A0A2J8KD82 A0A2J8SXD7 F8VV11
ENSP00000449373 ENSP00000449373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]