SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450452 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450452
Domain Number 1 Region: 20-142
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.87e-51
Family GABA-aminotransferase-like 0.000000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450452   Gene: ENSG00000182199   Transcript: ENST00000557703
Sequence length 142
Comment pep:putative chromosome:GRCh38:12:57230115:57231890:1 gene:ENSG00000182199 transcript:ENST00000557703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMG
Download sequence
Identical sequences A0A2J8UHB9 G3V241
ENSP00000450452 ENSP00000450452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]