SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450490 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450490
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-104
Family GABA-aminotransferase-like 0.000000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450490   Gene: ENSG00000182199   Transcript: ENST00000557529
Sequence length 264
Comment pep:putative chromosome:GRCh38:12:57232461:57234694:1 gene:ENSG00000182199 transcript:ENST00000557529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVA
AKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVF
PSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNH
LVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDD
FRRVVDFIDEGVNIGLEVKSKTGE
Download sequence
Identical sequences H0YIZ0
ENSP00000450490 ENSP00000450490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]