SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450594 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450594
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000842
Family GABA-aminotransferase-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450594   Gene: ENSG00000182199   Transcript: ENST00000557269
Sequence length 52
Comment pep:known chromosome:GRCh38:12:57229740:57232773:1 gene:ENSG00000182199 transcript:ENST00000557269 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNGFSCLCVCPAQNWPH
Download sequence
Identical sequences A0A2J8KWC3 A0A2J8UHC0 G3V2D2
ENSP00000450594 ENSP00000450594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]