SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450610 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450610
Domain Number 1 Region: 41-171
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.05e-54
Family GABA-aminotransferase-like 0.000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450610   Gene: ENSG00000182199   Transcript: ENST00000557433
Sequence length 171
Comment pep:known chromosome:GRCh38:12:57229759:57234726:1 gene:ENSG00000182199 transcript:ENST00000557433 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELL
QREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGQ
Download sequence
Identical sequences A0A2J8UHA7 G3V2E4
ENSP00000450610 ENSP00000450610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]