SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450930 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450930
Domain Number 1 Region: 1-233
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.91e-97
Family GABA-aminotransferase-like 0.00000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450930   Gene: ENSG00000182199   Transcript: ENST00000555634
Sequence length 234
Comment pep:putative chromosome:GRCh38:12:57229723:57233811:1 gene:ENSG00000182199 transcript:ENST00000555634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLI
IAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKT
LRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQ
ACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGAR
Download sequence
Identical sequences G3V2Y4
ENSP00000450930 ENSP00000450930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]