SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000451371 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451371
Domain Number 1 Region: 20-177
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.86e-65
Family GABA-aminotransferase-like 0.0000000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451371   Gene: ENSG00000182199   Transcript: ENST00000553837
Sequence length 192
Comment pep:known chromosome:GRCh38:12:57230384:57234726:1 gene:ENSG00000182199 transcript:ENST00000553837 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCS
RAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
SGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNGFS
CLCVCPAQNWPH
Download sequence
Identical sequences A0A2J8UH82 G3V540
ENSP00000451371 ENSP00000452163 ENSP00000451371 ENSP00000452163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]