SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452035 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452035
Domain Number 1 Region: 45-237
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.54e-82
Family GABA-aminotransferase-like 0.00000000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452035   Gene: ENSG00000182199   Transcript: ENST00000556689
Sequence length 237
Comment pep:novel chromosome:GRCh38:12:57229724:57232822:1 gene:ENSG00000182199 transcript:ENST00000556689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELL
QREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRISATSIFFESMPYKLNVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTT
Download sequence
Identical sequences G3V4W5
ENSP00000452035 ENSP00000452035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]