SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000452189 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452189
Domain Number 1 Region: 51-364
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.24e-77
Family GABA-aminotransferase-like 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452189   Gene: ENSG00000100596   Transcript: ENST00000554901
Sequence length 407
Comment pep:putative chromosome:GRCh38:14:77535600:77597321:-1 gene:ENSG00000100596 transcript:ENST00000554901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENFYT
RNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFAR
NTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFATNS
MNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRT
RRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVEYF
GLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSM
KCIMGQDGTSLGNGITIHEVVQTRNTYHRFSPLSPVFSHQCLWIMLP
Download sequence
Identical sequences H0YJV2
ENSP00000452189 ENSP00000452189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]