SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000454107 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454107
Domain Number 1 Region: 26-118
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-20
Family ALDH-like 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454107   Gene: ENSG00000184254   Transcript: ENST00000558033
Sequence length 141
Comment pep:known chromosome:GRCh38:15:100879813:100896014:1 gene:ENSG00000184254 transcript:ENST00000558033 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAMTTSC
ASPGMSPLVSVGPSLHGTSPC
Download sequence
Identical sequences H0YNQ3
ENSP00000454107 ENSP00000454107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]