SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000454910 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000454910
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.63e-28
Family Pyridoxal-dependent decarboxylase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000454910   Gene: ENSG00000179889   Transcript: ENST00000567306
Sequence length 271
Comment pep:putative chromosome:GRCh38:16:14976763:15017387:1 gene:ENSG00000179889 transcript:ENST00000567306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGDEDE
EPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGC
AYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQDV
AFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLA
LGYVSSSVLAAAKCDSMTMTPGPWLGLPAVP
Download sequence
Identical sequences H3BNL6
ENSP00000454910 ENSP00000454910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]