SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455618 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455618
Domain Number 1 Region: 7-117
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.81e-20
Family GABA-aminotransferase-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455618   Gene: ENSG00000139631   Transcript: ENST00000483632
Sequence length 142
Comment pep:known chromosome:GRCh38:12:53161322:53173374:-1 gene:ENSG00000139631 transcript:ENST00000483632 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
IQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGHPRFFNQ
LFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGDGIFCPVS
LLHPEGSCVSGTWHRQCPSGQG
Download sequence
Identical sequences H3BQ59
ENSP00000455618 ENSP00000455618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]