SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457264 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457264
Domain Number 1 Region: 37-129
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000762
Family AAT-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457264   Gene: ENSG00000139631   Transcript: ENST00000498635
Sequence length 129
Comment pep:known chromosome:GRCh38:12:53171946:53173919:-1 gene:ENSG00000139631 transcript:ENST00000498635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL
RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEE
Download sequence
Identical sequences H3BTP4
ENSP00000457264 ENSP00000457264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]