SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457371 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457371
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000000000000173
Family N-terminal domain of MutM-like DNA repair proteins 0.00000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457371   Gene: ENSG00000140398   Transcript: ENST00000569506
Sequence length 82
Comment pep:known chromosome:GRCh38:15:75348399:75349151:1 gene:ENSG00000140398 transcript:ENST00000569506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMS
Download sequence
Identical sequences H3BTX5
ENSP00000457371 ENSP00000457371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]