SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457475 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457475
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.82e-21
Family AAT-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457475   Gene: ENSG00000166123   Transcript: ENST00000562132
Sequence length 177
Comment pep:putative chromosome:GRCh38:16:46884695:46909874:1 gene:ENSG00000166123 transcript:ENST00000562132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRI
LQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKIL
VSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEA
Download sequence
Identical sequences H3BU54
ENSP00000457475 ENSP00000457475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]