SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458053 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458053
Domain Number 1 Region: 91-277
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.18e-24
Family Adenylation domain of NAD+-dependent DNA ligase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458053   Gene: ENSG00000169371   Transcript: ENST00000564675
Sequence length 360
Comment pep:known chromosome:GRCh38:15:75598122:75625693:-1 gene:ENSG00000169371 transcript:ENST00000564675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWI
VVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN
QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPE
SLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD
YAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHSPDHPGCLMEN
Download sequence
Identical sequences O95149
NP_001036046.1.87134 NP_001036046.1.92137 NP_001036053.1.87134 NP_001036053.1.92137 NP_005692.1.87134 NP_005692.1.92137 gi|110611149|ref|NP_001036046.1| gi|110611151|ref|NP_001036053.1| gi|5031833|ref|NP_005692.1| GO.36572 ENSP00000309831 ENSP00000454852 ENSP00000456224 ENSP00000458053 9606.ENSP00000309831 ENSP00000309831 ENSP00000454852 ENSP00000456224 ENSP00000458053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]