SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462043 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462043
Domain Number 1 Region: 11-82
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.19e-21
Family GABA-aminotransferase-like 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462043   Gene: ENSG00000176974   Transcript: ENST00000580002
Sequence length 128
Comment pep:known chromosome:GRCh38:17:18328470:18363495:-1 gene:ENSG00000176974 transcript:ENST00000580002 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRLPCKLCCVHCPGGTPWAHHGPGPSGWGPPDPWVHDRQEE
NLCHVHLL
Download sequence
Identical sequences J3KRK5
ENSP00000462043 ENSP00000462043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]