SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462227 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462227
Domain Number 1 Region: 11-167
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.17e-61
Family GABA-aminotransferase-like 0.0000000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462227   Gene: ENSG00000176974   Transcript: ENST00000582653
Sequence length 167
Comment pep:known chromosome:GRCh38:17:18347514:18363346:-1 gene:ENSG00000176974 transcript:ENST00000582653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSG
SPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFF
Download sequence
Identical sequences J3KRZ5
ENSP00000462227 ENSP00000462227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]