SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463637 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463637
Domain Number 1 Region: 4-429
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-127
Family ALDH-like 0.0000000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463637   Gene: ENSG00000072210   Transcript: ENST00000579855
Sequence length 485
Comment pep:known chromosome:GRCh38:17:19648751:19677598:1 gene:ENSG00000072210 transcript:ENST00000579855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
Download sequence
Identical sequences P51648
gi|4557303|ref|NP_000373.1| ENSP00000176643 ENSP00000378942 ENSP00000463637 NP_000373.1.87134 NP_000373.1.92137 XP_016879845.1.92137 XP_016879846.1.92137 ENSP00000176643 ENSP00000378942 ENSP00000463637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]