SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000472803 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472803
Domain Number 1 Region: 115-320
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-53
Family DBL homology domain (DH-domain) 0.00000000584
Further Details:      
 
Domain Number 2 Region: 325-487
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-34
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 3 Region: 578-698
Classification Level Classification E-value
Superfamily SH2 domain 3.74e-26
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 4 Region: 726-784
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-22
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 5 Region: 13-78
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000147
Family Calponin-homology domain, CH-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472803   Gene: ENSG00000141968   Transcript: ENST00000599806
Sequence length 790
Comment pep:putative chromosome:GRCh38:19:6784118:6857366:1 gene:ENSG00000141968 transcript:ENST00000599806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVLPLYSRLDKRFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSAL
SWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYE
DLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEI
IFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLD
RVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKEN
LRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVE
RRSKMDRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIE
DQGAQGYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQML
LRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLP
KMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRV
KPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEV
KHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISR
PAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPAN
YVEEDYSEYC
Download sequence
Identical sequences Q96D37
ENSP00000472803 ENSP00000472803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]