SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000479110 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479110
Domain Number 1 Region: 1-436
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.08e-135
Family Pyridoxal-dependent decarboxylase 0.000000000000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479110   Gene: ENSG00000132437   Transcript: ENST00000622873
Sequence length 442
Comment pep:known chromosome:GRCh38:7:50458438:50561071:-1 gene:ENSG00000132437 transcript:ENST00000622873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLA
ARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMR
ASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSA
FICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQ
DSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRF
EICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESA
HVQRAWEHIKELAADVLRAERE
Download sequence
Identical sequences A0A087WV24
XP_005271802.1.92137 ENSP00000479110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]