SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000479551 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479551
Domain Number 1 Region: 207-283
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.88e-26
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-25
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479551   Gene: ENSG00000185340   Transcript: ENST00000611648
Sequence length 681
Comment pep:known chromosome:GRCh38:22:29307058:29312785:1 gene:ENSG00000185340 transcript:ENST00000611648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTT
SPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRRYSGDSDSSAS
SAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSP
AAPRLSRVSSPSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTP
TGPAPDPARAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSS
SSDEGSPCPGMGGPLDAPGSPLACTEPSRTWARGRMDTQPDRKPSRIPTPRGPRRPSGPA
ELGTWHALHSVTPRAEPDSWM
Download sequence
Identical sequences A0A5E8
ENSP00000478343 ENSP00000478908 ENSP00000479551 ENSP00000481012 gi|19923777|ref|NP_006469.2| gi|23065526|ref|NP_689422.1| NP_006469.2.87134 NP_006469.2.92137 NP_689422.1.87134 NP_689422.1.92137 XP_011528126.1.92137 XP_011528127.1.92137 XP_016884022.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]