SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000479560 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479560
Domain Number 1 Region: 11-72
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 3.53e-17
Family Eukaryotic RPB5 N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479560   Gene: ENSG00000099817   Transcript: ENST00000590060
Sequence length 83
Comment pep:known chromosome:GRCh38:19:1086595:1092346:-1 gene:ENSG00000099817 transcript:ENST00000590060 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
PASASQSARITEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYI
LEQFLQQELLINITEHESLSTSS
Download sequence
Identical sequences A0A087WVN5
ENSP00000479560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]