SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000482009 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482009
Domain Number 1 Region: 12-145
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000603
Family Cystathionine synthase-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482009   Gene: ENSG00000115919   Transcript: ENST00000613664
Sequence length 157
Comment pep:putative chromosome:GRCh38:2:142927659:142971393:1 gene:ENSG00000115919 transcript:ENST00000613664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRY
KILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIA
VILFSGVHFYTGQHFNIPAITKAGQAKVATLGSSSVP
Download sequence
Identical sequences A0A087WYQ7
ENSP00000482009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]