SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000482152 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482152
Domain Number 1 Region: 1-103,132-168
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000135
Family Pyridoxal-dependent decarboxylase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482152   Gene: ENSG00000275498   Transcript: ENST00000621760
Sequence length 204
Comment pep:known chromosome:GRCh38:CHR_HSCHR16_1_CTG1:14950335:15121664:-1 gene:ENSG00000275498 transcript:ENST00000621760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTPGPWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLWLSLQYLGLDGFV
ERIKHACQLSQRLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMT
PSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAGWSHCGTT
TRYDCVRSRLTTRLPGSTGEQAPP
Download sequence
Identical sequences Q6XYB5
ENSP00000482152 ENSP00000483806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]