SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483586 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483586
Domain Number 1 Region: 30-369
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.93e-44
Family Pyridoxal-dependent decarboxylase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483586   Gene: ENSG00000275498   Transcript: ENST00000611292
Sequence length 370
Comment pep:known chromosome:GRCh38:CHR_HSCHR16_1_CTG1:15074105:15121616:-1 gene:ENSG00000275498 transcript:ENST00000611292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVS
ILQLVQNLMHGDEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSD
TTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSA
AARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVA
NAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSVLAAAKCDSMTMTPG
PWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLWLSLQYLGLDGFVERIKHA
CQLSQRLQKV
Download sequence
Identical sequences J3KNK7
ENSP00000322807 ENSP00000478642 ENSP00000483586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]