SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483820 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483820
Domain Number 1 Region: 18-187
Classification Level Classification E-value
Superfamily RUN domain-like 4.32e-42
Family RUN domain 0.00073
Further Details:      
 
Domain Number 2 Region: 528-640
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000148
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 683-784
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000804
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSP00000483820
Domain Number - Region: 992-1049
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.048
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483820   Gene: ENSG00000276358   Transcript: ENST00000617688
Sequence length 1056
Comment pep:known chromosome:GRCh38:CHR_HSCHR17_2_CTG5:45435903:45490432:-1 gene:ENSG00000276358 transcript:ENST00000617688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVVENGLDPQAAIPVIKKKLVGSVKALQKQYVSLDTVVTSEDGDANTMCSALEAVFIH
GLHAKHIRAEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLTFVNTDVGRCRA
WLRLALNDGLMECYLKLLLQEQARLHEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSELDPLSTSGAELQRKESLDSISHSSGSEDIEVHHSGHK
IRRNQKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPDHCEEPMSCDSDLGTANAE
DSDRSLQEVLLEFSKAQVNSVPTNGLSQETEIPTPQASLSLHGLNTSTYLHCEAPAEPLP
AQAASGTQDGVHVQEPRPQAPSPLDLQQPVESTSGQQPSSTVSETAREVGQGNGLQKAQA
HDGAGLKLVVSSPTSPKNKSWISEDDFYRPSREQPLESASDHPIASYRGTPGSRPGLHRH
FSQEPRKNCSLGALDQACVPSPGRRQAQAAPSQGHKSFRVVHRRQMGLSNPFRGLMKLGT
VERRGAMGIWKELFCELSPLEFRLYLSNEEHTCVENCSLLRCESVGPAHSDGRFELVFSG
KKLALRASSQDEAEDWLDRVREALQKVRPQQEDEWVNVQYPDQPEEPPEAPQGCLSPSDL
LSEPAALQGTQFDWSSAQVPEPDAIKESLLYLYMDRTWMPYIFSLSLEALKCFRIRNNEK
MLSDSHGVETIRDILPDTSLGGPSFFKIITAKAVLKLQAGNAEEAALWRDLVRKVLASYL
ETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPMEKGLDSQGCFCAGCSRQIGF
SFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALKFLTQIRAQPLIN
LQMVNASLYEHVERMHLIGRRREQLKLLGDYLGLCRSGALKELSKRLNHRNYLLESPHRF
SVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVR
CAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA
Download sequence
Identical sequences Q9Y4G2
ENSP00000389913 ENSP00000448185 ENSP00000389913 ENSP00000448053 gi|40538728|ref|NP_055613.1| 9606.ENSP00000389913 9606.ENSP00000414352 NP_055613.1.87134 NP_055613.1.92137 XP_011523825.1.92137 XP_011523826.1.92137 XP_016880940.1.92137 ENSP00000389913 ENSP00000479066 ENSP00000483820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]