SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000484801 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484801
Domain Number 1 Region: 20-231
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-23
Family Cystathionine synthase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484801   Gene: ENSG00000115919   Transcript: ENST00000621320
Sequence length 236
Comment pep:putative chromosome:GRCh38:2:142885395:142964752:1 gene:ENSG00000115919 transcript:ENST00000621320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAI
YFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEK
EIALMNALTVNLHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRM
IKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKVV
Download sequence
Identical sequences A0A087X297
ENSP00000484801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]