SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000078429 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000078429
Domain Number 1 Region: 38-67,184-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.45e-59
Family G proteins 0.0000000194
Further Details:      
 
Domain Number 2 Region: 67-186
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 6.8e-42
Family Transducin (alpha subunit), insertion domain 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000078429   Gene: ENSG00000088256   Transcript: ENST00000078429
Sequence length 359
Comment pep:known chromosome:GRCh37:19:3094408:3124002:1 gene:ENSG00000088256 transcript:ENST00000078429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
Download sequence
Identical sequences K7DI41 P29992
gi|115511049|ref|NP_002058.2| 9606.ENSP00000078429 NP_002058.2.87134 NP_002058.2.92137 XP_016792519.1.37143 ENSP00000078429 ENSP00000078429 ENSP00000078429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]