SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000189444 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000189444
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.71e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000808
Further Details:      
 
Domain Number 2 Region: 487-705
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.05e-57
Family Ankyrin repeat 0.00000869
Further Details:      
 
Domain Number 3 Region: 226-358
Classification Level Classification E-value
Superfamily E set domains 6.3e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000185
Further Details:      
 
Domain Number 4 Region: 769-848
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000753
Family DEATH domain, DD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000189444   Gene: ENSG00000077150   Transcript: ENST00000189444
Sequence length 899
Comment pep:known chromosome:GRCh37:10:104155463:104162281:1 gene:ENSG00000077150 transcript:ENST00000189444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Download sequence
Identical sequences NP_001248332.1.87134 NP_001248332.1.92137 NP_001275653.1.87134 NP_001275653.1.92137 NP_002493.3.87134 NP_002493.3.92137 ENSP00000189444 ENSP00000410256 ENSP00000189444 ENSP00000410256 gi|117320527|ref|NP_002493.3| gi|117320540|ref|NP_001070961.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]