SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000202625 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000202625
Domain Number 1 Region: 143-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-124
Family Transglutaminase core 0.00000000363
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily E set domains 2.27e-43
Family Transglutaminase N-terminal domain 0.0000825
Further Details:      
 
Domain Number 3 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.47e-26
Family Transglutaminase, two C-terminal domains 0.0003
Further Details:      
 
Domain Number 4 Region: 608-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.33e-24
Family Transglutaminase, two C-terminal domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000202625   Gene: ENSG00000166948   Transcript: ENST00000202625
Sequence length 706
Comment pep:known chromosome:GRCh37:20:2361554:2413399:1 gene:ENSG00000166948 transcript:ENST00000202625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEEILIFTMET
GPRASEALHTKAVFQTSELERGEGWTAAREAQMEKTLTVSLASPPSAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLSDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPGHQNNPATDVSCRHNPIYVTRVISAMVNSNNDRGVVQGQWQG
KYGGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVLCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEASGRRIWIRRAGGRC
LWRDDLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTR
KPVAEILHESHAVRLGPQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAMVGVAVTVEVTVVNPLIERVKDCALMVEGSGLLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
Download sequence
Identical sequences O95932
ENSP00000202625 ENSP00000202625 ENSP00000202625 gi|148664232|ref|NP_945345.2| 9606.ENSP00000202625 NP_945345.2.87134 NP_945345.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]