SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000206765 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000206765
Domain Number 1 Region: 254-563
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.1e-115
Family Transglutaminase core 0.0000000197
Further Details:      
 
Domain Number 2 Region: 92-253
Classification Level Classification E-value
Superfamily E set domains 4.55e-45
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 689-788
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.0005
Further Details:      
 
Domain Number 4 Region: 577-688
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-29
Family Transglutaminase, two C-terminal domains 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000206765   Gene: ENSG00000092295   Transcript: ENST00000206765
Sequence length 817
Comment pep:known chromosome:GRCh37:14:24718320:24732416:-1 gene:ENSG00000092295 transcript:ENST00000206765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDD
WGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSS
RSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTH
VIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPR
NEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESI
KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDI
TYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVML
INHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLV
DQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVT
LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHG
VIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Download sequence
Identical sequences P22735
ENSP00000206765 ENSP00000206765 NP_000350.1.87134 NP_000350.1.92137 NYSGRC-IgSF-TGM1_HUMAN ENSP00000206765 9606.ENSP00000206765 gi|4507475|ref|NP_000350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]