SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000220420 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000220420
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.99e-129
Family Transglutaminase core 0.00000000697
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 4.55e-41
Family Transglutaminase N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 619-717
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.12e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 4 Region: 506-617
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-27
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000220420   Gene: ENSG00000104055   Transcript: ENST00000220420
Sequence length 720
Comment pep:known chromosome:GRCh37:15:43524793:43559055:-1 gene:ENSG00000104055 transcript:ENST00000220420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPAYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQP
SRPTSLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences O43548
9606.ENSP00000220420 ENSP00000220420 gi|94981556|ref|NP_963925.2| ENSP00000220420 NP_963925.2.87134 NP_963925.2.92137 ENSP00000220420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]