SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000221249 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000221249
Domain Number 1 Region: 927-1202
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.31e-55
Family Patatin 0.049
Further Details:      
 
Domain Number 2 Region: 141-279
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-24
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 3 Region: 591-709
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-22
Family cAMP-binding domain 0.009
Further Details:      
 
Domain Number 4 Region: 474-593
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-19
Family cAMP-binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000221249   Gene: ENSG00000032444   Transcript: ENST00000221249
Sequence length 1327
Comment pep:known chromosome:GRCh37:19:7598890:7626650:1 gene:ENSG00000032444 transcript:ENST00000221249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPLQTGMVLGVMIGAGVAVVVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYG
RKIMRKVSQSTSSLVDTSVSATSRPRMRKKLKMLNIAKKILRIQKETPTLQRKEPPPAVL
EADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQP
DASIYVVQDGLLELCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAA
RDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQP
LRLFPSPGLPTRTSPVRGSKRMVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLE
TPSAPLLSRCVSMPGDISGLQGGPRSDFDMAYERGRISVSLQEEASGGSLAAPARTPTQE
PREQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRV
LLHHAKAGTIIARQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLT
GEPLIFTLRAQRDCTFLRISKSDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWT
AVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPR
ATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPAGSGLG
VPPHSELTNPASNLATVAILPVCAEVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGAS
ALDSIQEFRLSGWLAQQEDAHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQ
LEQMLENTAVRALKQLVLLHREEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAK
LHELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVD
LVGGTSIGSFIGALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNR
SIHRVFQDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKD
GHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWA
DKVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQ
YGKAVFGGWSRGNVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYV
SDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEP
PGSATDA
Download sequence
Identical sequences gi|116256487|ref|NP_006693.3| gi|260656041|ref|NP_001159585.1| NP_001159585.1.87134 NP_001159585.1.92137 NP_006693.3.87134 NP_006693.3.92137 9606.ENSP00000221249 ENSP00000221249 ENSP00000394348 ENSP00000221249 ENSP00000394348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]