SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000221452 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000221452
Domain Number 1 Region: 124-305
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.35e-64
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 300-433
Classification Level Classification E-value
Superfamily E set domains 1.38e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000221452   Gene: ENSG00000104856   Transcript: ENST00000221452
Sequence length 579
Comment pep:known chromosome:GRCh37:19:45504688:45541452:1 gene:ENSG00000104856 transcript:ENST00000221452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
Download sequence
Identical sequences Q01201
ENSP00000221452 ENSP00000445542 ENSP00000221452 HR2846 NP_006500.2.87134 NP_006500.2.92137 ENSP00000221452 9606.ENSP00000221452 gi|35493878|ref|NP_006500.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]