SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000222250 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000222250
Domain Number 1 Region: 165-338
Classification Level Classification E-value
Superfamily E set domains 9.1e-34
Family Arrestin/Vps26-like 0.024
Further Details:      
 
Domain Number 2 Region: 8-163
Classification Level Classification E-value
Superfamily E set domains 1.26e-23
Family Arrestin/Vps26-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000222250   Gene: ENSG00000105643   Transcript: ENST00000222250
Sequence length 407
Comment pep:known chromosome:GRCh37:19:18118977:18124911:1 gene:ENSG00000105643 transcript:ENST00000222250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
ESRSAGSSTAYTQSYSERVEVVSHRATLLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSF
EGKHGSVRYCIKATLHRPWVPARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCN
RGLVSLSAKIDRKGYTPGEVIPVFAEIDNGSTRPVLPRAAVVQTQTFMARGARKQKRAVV
ASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDYALKVCVDIPGTSKLLLELPL
VIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPEAPPEYSEVVADTEEAALGQSPFP
LPQDPDMSLEGPFFAYIQEFRYRPPPLYSEEDPNPLLGDMRPRCMTC
Download sequence
Identical sequences A0A024R7K1 Q8TBH0
ENSP00000368977 gi|18373305|ref|NP_056498.1| ENSP00000222250 NP_056498.1.87134 NP_056498.1.92137 ENSP00000222250 9606.ENSP00000222250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]