SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000229328 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000229328
Domain Number 1 Region: 174-270
Classification Level Classification E-value
Superfamily AMPKBI-like 1.32e-34
Family AMPKBI-like 0.00000831
Further Details:      
 
Domain Number 2 Region: 78-161
Classification Level Classification E-value
Superfamily E set domains 1.68e-27
Family AMPK-beta glycogen binding domain-like 0.00000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000229328   Gene: ENSG00000111725   Transcript: ENST00000229328
Sequence length 270
Comment pep:known chromosome:GRCh37:12:120105558:120119435:1 gene:ENSG00000111725 transcript:ENST00000229328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences A0A024RBN1 A0A096N4C2 A0A0D9S4F8 A0A2K5EEE9 A0A2K5J1Y9 A0A2K5LCA5 A0A2K5PTW9 A0A2K6CPW7 A0A2K6L9N5 F7BMG6 F7GTI4 G2HGR1 G3RB90 G7PIT4 Q9Y478
ENSPANP00000007235 ENSMMUP00000026113 ENSP00000229328 ENSP00000441369 ENSCJAP00000016725 ENSP00000229328 ENSP00000441369 ENSP00000229328 4zhx_B 4zhx_D 5ezv_B 5ezv_D 6b1u_B 6b1u_D 9544.ENSMMUP00000026113 9598.ENSPTRP00000009369 9606.ENSP00000229328 ENSCJAP00000016725 ENSCJAP00000048298 ENSMMUP00000026113 NP_001233530.1.37143 NP_001253044.1.72884 NP_006244.2.87134 NP_006244.2.92137 XP_003832451.1.60992 XP_004054030.1.27298 XP_005253966.1.92137 XP_005572434.1.63531 XP_008003095.1.81039 XP_008956042.1.60992 XP_011762203.1.29376 XP_011784112.1.43180 XP_011784113.1.43180 XP_011930490.1.92194 XP_012324402.1.9421 XP_012324403.1.9421 XP_017365698.1.71028 XP_017734552.1.44346 XP_017831902.1.60252 XP_018894373.1.27298 ENSGGOP00000012730 GO.34692 HR12 gi|19923359|ref|NP_006244.2| ENSPTRP00000009369 ENSGGOP00000012730 ENSPTRP00000009369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]