SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000230568 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000230568
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily E set domains 0.000000793
Family ML domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000230568   Gene: ENSG00000112799   Transcript: ENST00000230568
Sequence length 162
Comment pep:known chromosome:GRCh37:6:6588902:6654864:1 gene:ENSG00000112799 transcript:ENST00000230568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS
Download sequence
Identical sequences O95711
9606.ENSP00000230568 HR95 ENSP00000230568 ENSP00000369286 ENSP00000230568 gi|4758708|ref|NP_004262.1| ENSP00000230568 ENSP00000369286 NP_004262.1.87134 NP_004262.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]