SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000232447 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000232447
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.59e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1305-1417
Classification Level Classification E-value
Superfamily E set domains 2.27e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 3 Region: 1419-1527
Classification Level Classification E-value
Superfamily E set domains 2.87e-33
Family Filamin repeat (rod domain) 0.00000307
Further Details:      
 
Domain Number 4 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 1.4e-31
Family Filamin repeat (rod domain) 0.000000834
Further Details:      
 
Domain Number 5 Region: 1494-1611
Classification Level Classification E-value
Superfamily E set domains 6.14e-31
Family Filamin repeat (rod domain) 0.0000281
Further Details:      
 
Domain Number 6 Region: 1592-1707
Classification Level Classification E-value
Superfamily E set domains 6.34e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 7 Region: 1037-1127
Classification Level Classification E-value
Superfamily E set domains 1.13e-30
Family Filamin repeat (rod domain) 0.00000301
Further Details:      
 
Domain Number 8 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 1.07e-29
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 9 Region: 720-843
Classification Level Classification E-value
Superfamily E set domains 6.67e-29
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 10 Region: 1817-1912
Classification Level Classification E-value
Superfamily E set domains 2e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 11 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 2.54e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 12 Region: 643-751
Classification Level Classification E-value
Superfamily E set domains 5.87e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 13 Region: 2150-2242
Classification Level Classification E-value
Superfamily E set domains 1.13e-26
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 14 Region: 1130-1239
Classification Level Classification E-value
Superfamily E set domains 1.6e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 15 Region: 352-451
Classification Level Classification E-value
Superfamily E set domains 3.47e-25
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 16 Region: 252-349
Classification Level Classification E-value
Superfamily E set domains 3.6e-25
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 17 Region: 2470-2560
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 18 Region: 2341-2432
Classification Level Classification E-value
Superfamily E set domains 1.93e-24
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 19 Region: 2248-2339
Classification Level Classification E-value
Superfamily E set domains 5.54e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 20 Region: 537-639
Classification Level Classification E-value
Superfamily E set domains 6.41e-24
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 21 Region: 951-1051
Classification Level Classification E-value
Superfamily E set domains 1.22e-21
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 22 Region: 1997-2081
Classification Level Classification E-value
Superfamily E set domains 5e-21
Family Filamin repeat (rod domain) 0.00000817
Further Details:      
 
Domain Number 23 Region: 2085-2164
Classification Level Classification E-value
Superfamily E set domains 1.27e-19
Family Filamin repeat (rod domain) 0.0000393
Further Details:      
 
Domain Number 24 Region: 1908-1996
Classification Level Classification E-value
Superfamily E set domains 5.8e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1755-1831
Classification Level Classification E-value
Superfamily E set domains 3.47e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000232447   Gene: ENSG00000136068   Transcript: ENST00000348383
Sequence length 2561
Comment pep:known chromosome:GRCh37:3:57994127:58157982:1 gene:ENSG00000136068 transcript:ENST00000348383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPEINSSDMSAHVTSPSGRVT
EAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGP
GLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYE
VSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDA
KVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQA
GNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVM
YTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC
YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSM
KHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences ENSP00000232447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]