SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000238633 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000238633
Domain Number 1 Region: 21-145
Classification Level Classification E-value
Superfamily E set domains 8.4e-42
Family ML domain 0.000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000238633   Gene: ENSG00000119655   Transcript: ENST00000238633
Sequence length 148
Comment pep:novel chromosome:GRCh37:14:74946645:74959994:-1 gene:ENSG00000119655 transcript:ENST00000238633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVSHL
Download sequence
Identical sequences A0A2J8PJP3 F7HRU3 J3KMY5
XP_011804959.1.43180 XP_012353567.1.23891 ENSP00000238633 ENSP00000238633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]