SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000251921 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000251921
Domain Number - Region: 11-38
Classification Level Classification E-value
Superfamily E set domains 0.03
Family Filamin repeat (rod domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000251921   Gene: ENSG00000095110   Transcript: ENST00000251921
Sequence length 405
Comment pep:known chromosome:GRCh37:11:114392437:114430580:-1 gene:ENSG00000095110 transcript:ENST00000251921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPALTAGASGKVMDFNNGTYLVSFTLFWEGQVSLSLLLIHPSEGASALWRARNQGYDK
IIFKGKFVNGTSHVFTECGLTLNSNAELCEYLDDRDQEAFYCMKPQHMPCEALTYMTTRN
REVSYLTDKENSLFHRSKVGVEMMKDRKHIDVTNCNKREKIEETCQVGMKPPVPGGYTLQ
GKWITTFCNQVQLDTIKINGCLKGKLIYLLGDSTLRQWIYYFPKVVKTLKFFDLHETGIF
KKHLLLDAERHTQIQWKKHSYPFVTFQLYSLIDHDYIPREIDRLSGDKNTAIVITFGQHF
RPFPIDIFIRRAIGVQKAIERLFLRSPATKVIIKTENIREMHIETERFGDFHGYIHYLIM
KDIFKDLNVGIIDAWDMTIAYGTDTIHPPDHVIGNQINMFLNYIC
Download sequence
Identical sequences NP_689528.2.87134 NP_689528.2.92137 ENSP00000251921 9606.ENSP00000251921 gi|169234964|ref|NP_689528.2| ENSP00000251921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]