SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000261336 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261336
Domain Number 1 Region: 964-1273
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.24e-91
Family Complement components 0.0000317
Further Details:      
 
Domain Number 2 Region: 1346-1477
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.76e-40
Family Alpha-macroglobulin receptor domain 0.000000789
Further Details:      
 
Domain Number 3 Region: 792-912
Classification Level Classification E-value
Superfamily E set domains 3.08e-35
Family SVA-like 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000261336
Domain Number - Region: 400-473
Classification Level Classification E-value
Superfamily ADC synthase 0.00916
Family ADC synthase 0.017
Further Details:      
 
Domain Number - Region: 360-417
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0353
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261336   Gene: ENSG00000126838   Transcript: ENST00000261336
Sequence length 1482
Comment pep:known chromosome:GRCh37:12:9301436:9360966:-1 gene:ENSG00000126838 transcript:ENST00000261336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKDRLLHLCLVLLLILLSASDSNSTEPQYMVLVPSLLHTEAPKKGCVLLSHLNETVTVS
ASLESGRENRSLFTDLVAEKDLFHCVSFTLPRISASSEVAFLSIQIKGPTQDFRKRNTVL
VLNTQSLVFVQTDKPMYKPGQTVRFRVVSVDENFRPRNELIPLIYLENPRRNRIAQWQSL
KLEAGINQLSFPLSSEPIQGSYRVVVQTESGGRIQHPFTVEEFVLPKFEVKVQVPKIISI
MDEKVNITVCGEYTYGKPVPGLATVSLCRKLSRVLNCDKQEVCEEFSQQLNSNGCITQQV
HTKMLQITNTGFEMKLRVEARIREEGTDLEVTANRISEITNIVSKLKFVKVDSHFRQGIP
FFAQVLLVDGKGVPIPNKLFFISVNDANYYSNATTNEQGLAQFSINTTSISVNKLFVRVF
TVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYTLNR
QAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFA
ILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSV
LLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEA
DIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYN
VIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSE
DAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQLKASPAF
LASQNTKGEESYCICGNERQTLSWTVTPKTLGNVNFSVSAEAMQSLELCGNEVVEVPEIK
RKDTVIKTLLVEAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDI
LGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQR
QLNYKHQDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARSYIFIDEAHITQSLTWLSQMQ
KDNGCFRSSGSLLNNAIKGGVEDEATLSAYVTIALLEIPLPVTNPIVRNALFCLESAWNV
AKEGTHGSHVYTKALLAYAFSLLGKQNQNREILNSLDKEAVKEDNLVHWERPQRPKAPVG
HLYQTQAPSAEVEMTSYVLLAYLTAQPAPTSGDLTSATNIVKWIMKQQNAQGGFSSTQDT
VVALHALSRYGAATFTRTEKTAQVTVQDSQTFSTNFQVDNNNLLLLQQISLPELPGEYVI
TVTGERCVYLQTSMKYNILPEKEDSPFALKVQTVPQTCDGHKAHTSFQISLTISYTGNRP
ASNMVIVDVKMVSGFIPLKPTVKMLERSSSVSRTEVSNNHVLIYVEQVTNQTLSFSFMVL
QDIPVGDLKPAIVKVYDYYETDESVVAEYIAPCSTDTEHGNV
Download sequence
Identical sequences P20742
ENSP00000261336 gi|162809334|ref|NP_002855.2| ENSP00000261336 NP_002855.2.87134 NP_002855.2.92137 9606.ENSP00000261336 ENSP00000261336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]