SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000261514 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261514
Domain Number 1 Region: 115-161,201-465,500-645
Classification Level Classification E-value
Superfamily Clc chloride channel 9.16e-128
Family Clc chloride channel 0.00013
Further Details:      
 
Domain Number 2 Region: 643-805
Classification Level Classification E-value
Superfamily CBS-domain pair 9.85e-28
Family CBS-domain pair 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261514   Gene: ENSG00000109572   Transcript: ENST00000347613
Sequence length 866
Comment pep:known chromosome:GRCh37:4:170541677:170641696:1 gene:ENSG00000109572 transcript:ENST00000347613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMT
NGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTK
SLYDAWSGWLVVTLTGLASGALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETT
FEERDKCPQWKTWAELIIGQAEGPGSYIMNYIMYIFWALSFAFLAVSLVKVFAPYACGSG
IPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLGKEGPLVHVACCCGNIFSYLF
PKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAA
FVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNA
SKIVDDIPDRPAGIGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRI
VGIAVEQLAYYHHDWFIFKEWCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFEL
TGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRP
RRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKESQRLVGFALRRDLTIAIESAR
KKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGL
RQCLVTHNGIVLGIITKKNILEHLEQLKQHVEPLAPPWHYNKKRYPPAYGPDGKPRPRFN
NVQLNLTDEEREETEEEVYLLNSTTL
Download sequence
Identical sequences A0A096N8D7 A0A2I3TDA6 A0A2K5MD25 A0A2K5WZE6 A0A2K5ZHI2 G1R4F3 H9EPI1
ENSPTRP00000028471 ENSPTRP00000028471 ENSP00000261514 9598.ENSPTRP00000028471 9606.ENSP00000261514 ENSNLEP00000008075 NP_776297.2.87134 NP_776297.2.92137 XP_001153846.1.37143 XP_003258009.1.23891 XP_005556333.1.63531 XP_005556334.1.63531 XP_007998435.1.81039 XP_011823194.1.47321 XP_011941790.1.92194 XP_014994981.1.72884 XP_014994982.1.72884 ENSP00000261514 ENSP00000422678 gi|55770840|ref|NP_776297.2| ENSNLEP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]