SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000262318 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262318
Domain Number 1 Region: 80-410,443-593
Classification Level Classification E-value
Superfamily Clc chloride channel 1.28e-104
Family Clc chloride channel 0.00042
Further Details:      
 
Domain Number 2 Region: 595-725
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000279
Family CBS-domain pair 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262318   Gene: ENSG00000103249   Transcript: ENST00000262318
Sequence length 901
Comment pep:putative chromosome:GRCh37:16:1495345:1525058:-1 gene:ENSG00000103249 transcript:ENST00000262318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVSKKVSWSGRDRDDEEAAPLLRRTARPGGGTPLLNGAGPGAARQDMDPPHPFPKEIP
HNEKLLSLKYESLDYDNSENQLFLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFI
DIVVENLAGLKYRVIKGNIDKFTEKGGLSFSLLLWATLNAAFVLVGSVIVAFIEPVAAGS
GIPQIKCFLNGVKIPHVVRLKTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQG
RSTSLKRDFKIFEYFRRDTEKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEGASFWNQFLT
WRIFFASMISTFTLNFVLSIYHGNMWDLSSPGLINFGRFDSEKMAYTIHEIPVFIAMGVV
GGVLGAVFNALNYWLTMFRIRYIHRPCLQVIEAVLVAAVTATVAFVLIYSSRDCQPLQGG
SMSYPLQLFCADGEYNSMAAAFFNTPEKSVVSLFHDPPGSYNPLTLGLFTLVYFFLACWT
YGLTVSAGVFIPSLLIGAAWGRLFGISLSYLTGAAIWADPGKYALMGAAAQLGGIVRMTL
SLTVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEGLYDMHIQLQSVPFLHWEAPVTSHS
LTAREVMSTPVTCLRRREKVGVIVDVLSDTASNHNGFPVVEHADDTQPARLQGLILRSQL
IVLLKHKVFVERSNLGLVQRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPS
PYTVPQACVAPTGVQAVPGPGPAAPGGGGQPQSGCRVGDQEGPRQVPPGKERLGGALAGP
DVRPSPAHNGHWRWHPGPSAFPPGVTGFSAQTMLPSSGNGEHPAAGRAGGRRGTDPLAGL
TLLWAVVSPLGASLRRPSLHSPRLGFFTSRDQLCVCDLPTGLSASWEPAAGPAPACLCPC
A
Download sequence
Identical sequences H0Y2M6
ENSP00000410907 ENSP00000262318 ENSP00000262318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]