SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000264750 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264750
Domain Number 1 Region: 294-353
Classification Level Classification E-value
Superfamily RING/U-box 0.0000004
Family U-box 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264750   Gene: ENSG00000090316   Transcript: ENST00000264750
Sequence length 355
Comment pep:known chromosome:GRCh37:4:1283679:1333924:1 gene:ENSG00000090316 transcript:ENST00000264750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQESAAQLSMTLKVQEYPTLKVPYETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSG
CPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVW
KRKRMDRMMVEHLLRCGYYNTAVKLARQSGIESCLEFSLRIQEFIELIRQNKRLDAVRHA
RKHFSQAEGSQLDEVRQAMGMLAFPPDTHISPYKDLLDPARWRMLIQQFRYDNYRLHQLG
NNSVFTLTLQAGLSAIKTPQCYKEDGSSKSPDCPVCSRSLNKLAQPLPMAHCANSRLVCK
ISGDVMNENNPPMMLPNGYVYGYNSLLSIRQDDKVVCPRTKEVFHFSQAEKVYIM
Download sequence
Identical sequences A0A1D5QSW9 A0A2I2Z1W5 A0A2I3M3U7 A0A2J8SS45 A0A2K5EYJ8 A0A2K5KZE9 A0A2K5U860 A0A2K6B9S9 A0A2K6MLT0 A0A2K6RGI9 K7BG27
NP_005873.2.87134 NP_005873.2.92137 XP_004038370.1.27298 XP_010373639.1.97406 XP_011914681.1.92194 NYSGRC-62953129 ENSP00000264750 ENSMMUP00000010957 ENSP00000264750 gi|62953129|ref|NP_005873.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]