SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000264917 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264917
Domain Number 1 Region: 543-873
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.61e-106
Family PDEase 0.00000126
Further Details:      
 
Domain Number 2 Region: 275-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.21e-17
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSP00000264917
Domain Number - Region: 149-221
Classification Level Classification E-value
Superfamily CheY-like 0.00145
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264917   Gene: ENSG00000113231   Transcript: ENST00000264917
Sequence length 885
Comment pep:known chromosome:GRCh37:5:76506706:76725632:1 gene:ENSG00000113231 transcript:ENST00000264917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAPSIHVSQSGVIYCRDSDESSSPRQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASG
PPSVARVRRARTELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTCYTSVKQVSSAEV
RIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEII
VIDHRQTQNFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFME
NSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFER
MMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVK
ITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDV
KSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLE
ILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITI
NDVPPCISQLLDNEESWDFNIFELEAITHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAW
FQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHP
GRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAI
IDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQILIKRMMIKCA
DVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYF
ITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences O95263
gi|26006851|ref|NP_003710.1| 9606.ENSP00000264917 NP_003710.1.87134 NP_003710.1.92137 ENSP00000264917 ENSP00000264917 ENSP00000345446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]