SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265138 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265138
Domain Number 1 Region: 172-343
Classification Level Classification E-value
Superfamily E set domains 1.12e-31
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Domain Number 2 Region: 11-171
Classification Level Classification E-value
Superfamily E set domains 1.54e-27
Family Arrestin/Vps26-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265138   Gene: ENSG00000113369   Transcript: ENST00000265138
Sequence length 414
Comment pep:known chromosome:GRCh37:5:90664541:90679176:-1 gene:ENSG00000113369 transcript:ENST00000265138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWT
ESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFSFELPQ
TPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAGTKEKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKGKM
KEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAMD
LFLNLPLVIGTIPLHPFGSRTSSVSSQCSMNMNWLSLSLPERPEAPPSYAEVVTEEQRRN
NLAPVSACDDFERALQGPLFAYIQEFRFLPPPLYSEIDPNPDQSADDRPSCPSR
Download sequence
Identical sequences A0A2J8TD34 G3QNT9 Q96B67
ENSP00000265138 ENSGGOP00000004215 ENSP00000265138 NP_065852.1.87134 NP_065852.1.92137 XP_004042314.1.27298 ENSGGOP00000004215 gi|32698736|ref|NP_065852.1| ENSP00000265138 9606.ENSP00000265138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]