SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000269260 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000269260
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily E set domains 8.05e-81
Family Arrestin/Vps26-like 0.000000116
Further Details:      
 
Domain Number 2 Region: 178-393
Classification Level Classification E-value
Superfamily E set domains 4.11e-68
Family Arrestin/Vps26-like 0.0000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000269260   Gene: ENSG00000141480   Transcript: ENST00000269260
Sequence length 409
Comment pep:known chromosome:GRCh37:17:4613784:4624766:1 gene:ENSG00000141480 transcript:ENST00000269260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Download sequence
Identical sequences A0A2J8SPM5 P32121 Q5RCR4
9606.ENSP00000269260 gi|4757780|ref|NP_004304.1| HR3108 ENSNLEP00000021101 ENSP00000269260 ENSP00000269260 NP_004304.1.87134 NP_004304.1.92137 XP_003277906.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]